PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00000369-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 684aa    MW: 74648.3 Da    PI: 7.2783
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00000369-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-095035352254
                            SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            ++yp+ +++  LA+++gLt +qV++WF N R +
  SMil_00000369-RA_Salv 503 HPYPTDTDKHMLATQTGLTRNQVSNWFINARVR 535
                            89*****************************87 PP

2BELL106.51.8e-34359427472
                   BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            e+ ++kakLl +++eV+krYkqy++q+q+v+ssFe vagl +a+pY+slAlk i++hFrcLk+ i++q+
  SMil_00000369-RA_Salv 359 ENLQRKAKLLFMQDEVCKRYKQYHQQMQMVVSSFESVAGLSAATPYVSLALKMIAKHFRCLKNTITDQL 427
                            7789**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.4E-42264425IPR006563POX domain
PfamPF075261.6E-40269424IPR006563POX domain
PROSITE profilePS5007111.71476539IPR001356Homeobox domain
CDDcd000862.32E-11479540No hitNo description
SMARTSM003892.2E-8479543IPR001356Homeobox domain
SuperFamilySSF466896.84E-17481545IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-28482543IPR009057Homeodomain-like
PfamPF059207.0E-18496535IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
LSEREHMLRS VGALPGDDQF LCEPTAQGRL DGGRETGPLS ASFSPSATVS SSDPQYFSTC  60
DWVANHSSIY ANPISALDVK PNYLGYDQDM NGAASSLYQN ALQDLVTSSN NVRSFGLEFA  120
SLRHKSSGEA GHGPWVVGGS ELMLLPDQMR LKTQSGLITR PVDGCSQWSG ELEFAAPKDL  180
DRDHSNTQAL SLSLSSVPSP KVHEAQITER DFQTRDVCGS TNVQDSRIWK PELPSPNQNM  240
SAGSRVLGAQ ASTHRNPGPL GPFTGYATIL RSSRFLRPAQ QLLEDLCCIA GTKEVEACDV  300
SDEIMEEVRV SSEGASNNAE HAMAGNNSGG LSSFVYNGSS DKSRDAGGTS CSTDARRPEN  360
LQRKAKLLFM QDEVCKRYKQ YHQQMQMVVS SFESVAGLSA ATPYVSLALK MIAKHFRCLK  420
NTITDQLKSI KNALRDEFSS PSAGAGGNKG DANASVLKFF DQGFQKQKGT GILEGQHIWR  480
PQRGLPERAV SILRAWLFDH FLHPYPTDTD KHMLATQTGL TRNQVSNWFI NARVRVWKPM  540
VEEIHMLETK GSDNSGKSSN GKTADGGCAQ ADDSSQRLRT RAIPDKQVEC SSFVPPGQEG  600
DRSKASPWGQ EKRSRIEYHV PSSVDGTLMG FVPSHRNGIE MGGIGSVSLT LGLRQSPEGG  660
QRPAMQQERH MRHYGGQIIR DFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A6e-17485543563Homeobox protein Meis2
4xrm_B6e-17485543563Homeobox protein Meis2
4xrs_A4e-17485542158Homeobox protein Meis1
4xrs_B4e-17485542158Homeobox protein Meis1
5bng_A5e-17485543159Homeobox protein Meis2
5bng_B5e-17485543159Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089262.10.0PREDICTED: uncharacterized protein LOC105170277
TrEMBLA0A022PR430.0A0A022PR43_ERYGU; Uncharacterized protein
STRINGVIT_06s0004g02580.t011e-153(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87202227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.15e-85BEL1-like homeodomain 8